PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G284200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 291aa    MW: 32052.1 Da    PI: 5.6792
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G284200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092242572255
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  Brast01G284200.1.p 224 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 257
                         69*****************************885 PP

2ELK33.21.1e-11177198122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK++Ll+KYsg+L+ L++EF+
  Brast01G284200.1.p 177 ELKEMLLKKYSGCLSRLRSEFL 198
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-223680IPR005540KNOX1
PfamPF037901.8E-213878IPR005540KNOX1
SMARTSM012561.9E-2781132IPR005541KNOX2
PfamPF037912.7E-2485131IPR005541KNOX2
PROSITE profilePS5121310.423177197IPR005539ELK domain
PfamPF037891.3E-8177198IPR005539ELK domain
SMARTSM011883.6E-6177198IPR005539ELK domain
PROSITE profilePS5007112.649197260IPR001356Homeobox domain
SMARTSM003895.8E-14199264IPR001356Homeobox domain
SuperFamilySSF466897.7E-20199268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-27202262IPR009057Homeodomain-like
CDDcd000867.27E-13209261No hitNo description
PfamPF059204.7E-17217256IPR008422Homeobox KN domain
PROSITE patternPS000270235258IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEDLYSIHPG ISRLGGAASE ASGVVLGGPS PSDLTELMKA QIASHPRYPT LLSAYIECRK  60
VGAPPEVASL LEEIGRERRA GTGAIGVDPE LDEFMESYCR VLVRYKEELS RPFDEAASFL  120
SSIQTQLSNL CSGGSSPAAT ATHSDEMVGS SDDEQCSGET DGLDIGQEHS SRIADHELKE  180
MLLKKYSGCL SRLRSEFLKK RKKGKLPKDA RTALMDWWNT HYRWPYPTEE DKVRLAAMTG  240
LDPKQINNWF INQRKRHWKP SEDMRFALME GVTGGSSGTT LYFDTGTIGP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192201LRSEFLKKRK
2198202KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7819010.0AY781901.1 Saccharum hybrid cultivar Pindar isolate c53a homeobox protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567581.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-172KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLI1HEU40.0I1HEU4_BRADI; Uncharacterized protein
STRINGBRADI2G11540.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-87KNOTTED1-like homeobox gene 6